McDonnell Genome Institute

Washington University

CircRNA

chr20|35863012|35863400|+|PHF20|ENST00000339089.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9602

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

LNIVGNARPK

Amino Acids from 5' Exons

NIVGNARPKETDHKSLSSSPDKREKFKEQRKATVNVKKDKEDKPLKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKENISENDREYSGDAQVDKKPENDIVKSPQENLREPKRKRGRPPSIAPT,ILWVMLGLKKQITKVFHHLLINERSLKNREKQQMRKTKKINPRQKSDPSSLIKKESSVLKRGKCQRKVFPRTRRKTRKTFPKMTESILEMPKWIRNLKMTLRVHKKTGNPKENEADPLPLLL,YCGCARNRSQKSFIISTREVRTEKSNSECEERQRRTLKDRKATQAARRKVNLFKGESVREKSSQEREGRQGKHFRKQRVFWRCPSGETKHCEESTRKLEGTQKKTRQTPFHSSY

Amino Acids from 3' Exons

NIVGNARPKETDHKSLSSSPDKREKFKEQRKATVNVKKDKEDKPLKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKENISENDREYSGDAQVDKKPENDIVKSPQENLREPKRKRGRPPSIAPT,ILWVMLGLKKQITKVFHHLLINERSLKNREKQQMRKTKKINPRQKSDPSSLIKKESSVLKRGKCQRKVFPRTRRKTRKTFPKMTESILEMPKWIRNLKMTLRVHKKTGNPKENEADPLPLLL,YCGCARNRSQKSFIISTREVRTEKSNSECEERQRRTLKDRKATQAARRKVNLFKGESVREKSSQEREGRQGKHFRKQRVFWRCPSGETKHCEESTRKLEGTQKKTRQTPFHSSY