McDonnell Genome Institute

Washington University

CircRNA

chr20|35714184|35734257|-|RBM39|ENST00000429968.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9237

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

LSASLESSTSPCDWSVGFK

Amino Acids from 5' Exons

FSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAE,FLTQNVPKRLWNNLMDLNQEDQKLVMLLNVLMLRVLVHFWTVMNWKGLELIWEQLVVFSWQDLQR,FLRMCQKGFGTTWITSRKTNESWSCYTYCFECFIFGQTGKDWNFGNNWSSSVNGKTCR

Amino Acids from 3' Exons

TNFLPPWKALHLLVIGVWVSRFQK,QTFCLLGKLYISLLECGFQDSR,KLSASLESSTSPCDWSVGFKIPE