McDonnell Genome Institute

Washington University

CircRNA

chr20|35469889|35480145|+|CEP250|ENST00000397527.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9364

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

ALCSVDPVSEAK

Amino Acids from 5' Exons

GDRALCSVDPVSEAKRLKDDKGSERDSGDP,VTELSALLTQSQKQNEDYEKMIKALRETVEIL,PSSLLCPSLRSKMKIMKRRLERQWRS

Amino Acids from 3' Exons

GKGASWNWTLNGVRQSRSGMLQPDSWPRLSKKGRLPWSSRRQPMRKRTSSGRN,GSEVPEAGTGHTESGRAGAGCCSQTAGPGARREDCLGAAEGSPERGEPAPGEM,EVRCLKLELDTERSQAEQERDAAARQLAQAEQEGKTALEQQKAAHEKEVNQLREKW