McDonnell Genome Institute

Washington University

CircRNA

chr20|35044504|35057571|-|TRPC4AP|ENST00000252015.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.98

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

SLSLGPSAAEINQASCR

Amino Acids from 5' Exons

EMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLGPSAAEINQ,KSDMKSPIVPYPISISSSSLISAGFWLSPFQRWIQGMMTSTRFLPKMLNRRRAVWGLLQLKSIK,NDPTRSPQSEFLSIQFRSAAARFLPDSGCHHFRDGYREQAHASCQKCSTEEELEFGAFCSNQS

Amino Acids from 3' Exons

LLVEILMRPTISIRGQKLK,FLKFLGLRSLSGDRNK,SCRNSYEAYDLYPGTETE