top of page

McDonnell Genome Institute

Washington University

CircRNA

chr20|35000987|35001349|+|MYH7B|ENST00000262873.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9183

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

ELAYQAAMMAEELK

Amino Acids from 5' Exons

AAMMAEELKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQKLEAK,RPWPRSRRSRTQVHTWNGRRRWSRRCASSRPALRRQNRPPSVAGRSRCRSWRP,GHDGRGAEEGAGHKCTPGTDEEDAGADGARAPGPPGGRTGRPPWREEAGAEAGGQ

Amino Acids from 3' Exons

VRELEAELDAEQKKHAEALKGVRKHERRVKELAYQ,YGSWRLSLMQSRRSTPRPLRACASMSAVSRSSHT,TGAGGACRAEEARRGPGRAQAAPCQGARIP

bottom of page