McDonnell Genome Institute

Washington University

CircRNA

chr20|34740362|34776448|-|NCOA6|ENST00000359003.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9038

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

VGSHPELLPSIESSK

Amino Acids from 5' Exons

VILLNQLNRGHFSRCLLNSCSMWHPHHSHHSSSHSHNCLSSSSHHLPVSHSLSSSSSSSNKCSCSRIPNQLGFQSLKMSILQGAPTPTPRECPCNRVAVCLSWSVCKDLPPCHHHLINKECQCLILPWEAIQGKWSIRRARRILPARHWRRWPHSLKQVAVKHHLSQEAQTTCLHMYFPRISQGQNLDHRPFQQLKVQLPSNPLIPCPALTATTSQMWLRQPRHLGPKHQTEPAPDPIILRHPTTALPAQNLQKSVCHQKDSMPPQDSSLHRLIFLYLLGQITGALINKAIQQLRPSGKHLQILPILPILLPHKLTNILWILESSLILEQQNGQVQATVAGLVLGPVGKPLQALGGKIQKPLNLLWPLRQMQPYCRMWSCREMYWSVPLLWPIPLYLGAFLTTVGILRILLCLWLQLGVLLRITRRAMCLRTVIARIPRVGRNRTLNKQSLPKKLKWLSLKISPKRMGSLRILTNFPVSKRTKIWCLLLGKHQHRVNFLTTLELPMQLNPLGLQIWKHLQFLGRTSKKHLSFPHCRICLLLKNLLIPTYLTVMSCVHPLCIPNVRSVLTLHQASLQCQDLLALPPFPLPCPQIKLYLSLPIPSQLQLTHQQLCQLTCSLHCQQLSQCPMRVARLWFLRDSQLLSLMPGLSSLHLSLSIHPQFRLKDHSQAQFLQPHQPTLACLPLLQLLALYTYLRTNFLLLLYRLMPSPVVLLQTSRQVDLWSLAHEPPLFSFLPLLVRLLQLSLLIPLCSKKNIQMRLALRTPQQIRTLFPLHSQPQWFLPFPIVQGPLATGEAQSRLVRAKEKWTKLAKFCPRHVRKLQALLRKGKNNMVQMERLKAKGTPQLRGSWEQSSYPQSWTVKPQRPQHPLCKPLALWARALPQQDPAYLAVLSPPVYARPLWYPPSSSPPYRPQKAIMVAHLSHLRVAWRRRWDPIQNFYPA,LSFSTSTEATSADASSTHAACGTPTTATTAAATATTASAAAATTSQSATVSAAAAAAATNDDDAHDAAGSQISASSLSKCPSSKGPPEPRLPENAHATEWQCACHGQSARTCLRATITTKNANACEYSLGKQFKENGLSGEPAESFQLATGGDGLTPSKWQSTICPRRPKQHAFTCSTSPESVNDDRAKTWTIAPFSNSRCNSPATPCKFPAQLSRPPLPKCGCANPDIAQNTKQSQPQTLLSSDTQQPPSQHRTFRNQSVTRKTQCLHSRTLPSTDYSFTSAKFKQGLSTRPKSNNFEGHRASTFKSYHESFQFCYPTNSQIRFCGSEFWKAVFWSNKTGKSKQQSQVSWVQENHSKPWEAKFKSPTYSGLSDKCSPIAECGVAEKCIGQSHSSGQSPCTWELSQQWAESSEFYCVCGCSWGCCGQGELECASGQLPEFPEEGTGKHTKSSPCPRSNGCPRSVQKGWAAFGSQTSQCRREQKFGVSCYEGSTNIVKSTSQLWSSQCDNTPWAYRSGSNTSSSFWGGPQKSICHSHTAGSVFFRTFFPKLTSQAVFIPCASRIEGQFRCTKHPSSNVKTCLFLHFHSLAPKSNNCICHFQSHHNFSHISSFANSLAVCIDVNSCHNAQCGQGYGFGTVSCSVCPASVHYTCLYQFILNNSGYERITAKHNSCSPTDNQLWPDASLCCSCWPFTHTSEHKIFFCSCTACPLQSCSKHPDRSTFGPLTSHPCSASFPSLYVFSSCPFSSPCAASERIESRGPSGEHLSRSEHSSLFTVNHNGFSPFDQSRVLWQPAKPSLVGQRKSGQNWPNFVDQGMESYRLSERGRTIWCRWRDRPRARHHSSGAHGNRAVIHRAGQNPNAPSTHSAKNDLPCGPGHCLSRTQLTWRCSPHQCTLDSNHSGTLRAHLRRTDHKKQSWWHSIVTCGWPSGGEGGIPSRTSTQH,YPSQPVEQRPLQQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQPQSQQQQQQQQQMMMMLMMQQDPKSVRLPVSQNVHPPRGPLNPDSQRMPMQQSGSVPVMVSLQGPASVPPSPDKQRMPMPVNTPLGSNSRKMVYQESPQNPSSSPLAEMASLPEASGSEAPSVPGGPNNMPSHVVLPQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNVAAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPLPPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTMNPSNFATPQTHKLDSVVVNSGKQSNSGATKRASPSNSRRSSPGSSRKTTPSPGRQNSKAPKLTLASQTNAALLQNVELPRNVLVSPTPLANPPVPGSFPNNSGLNPQNSTVSVAAVGGVVEDNKESLNVPQDSDCQNSQSRKEQVNIELKAVPAQEVKMVVPEDQSKKDGQPSDPNKLPSVEENKNLVSPAMREAPTSLSQLLDNSGAPNVTIKPPGLTDLEVTPPVVSGEDLKKASVIPTLQDLSSSKEPSNSLNLPHSNELCSSLVHPELSEVSSNVAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSANTSAALPTHLQSALMSTVVTMPNAGSKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPAAPLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVPPNALSSSPAPNIQTGRPLVLSSRATPVQLPSPPCTSSPVVPSHPPVQQVKELNPDEASPQVNTSADQNTLPSSQSTTMVSPLLTNSPGSSGNRRSPVSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADGETEGQGLDTTAPGLMGTEQLSTELDSKTPTPPAPTLLKMTSSPVGPGTASAGPSLPGGALPTSVRSIVTTLVPSELISAVPTTKSNHGGIASESLAGGLVEEKVGSHPELLPSI

Amino Acids from 3' Exons

SPASKYRRWSPGTACVHSTSPGKQRSGYGSLLRATTSSFGIGFSPFRLK,VQQAKSTEGGALEQRACDIQHPPGSSGAATDPCSEQQPAASGFRDSLRSD,SSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLRDLGILSVQIE