McDonnell Genome Institute

Washington University

CircRNA

chr20|33379460|33379691|-|CDK5RAP1|ENST00000346416.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9465

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

DFPDEGLK

Amino Acids from 5' Exons

GLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRVDPEMRIRFTSPHPKDFPDE,GKKHFLVRMLIVFGTIRRSSSTVQCLPISVVALPPTIKPSKEDFVLLIFWIRSPEILKGSVLPLPTPRIFLM,AERSDTSWSECFSGQFGGPVQQCSAYQSQSWLYHQLNQARRTSFCSSSGSGLQSRSNEDPFYLSPPQGFS

Amino Acids from 3' Exons

GLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRVDPEMRIRFTSPHPKDFPDE,GKKHFLVRMLIVFGTIRRSSSTVQCLPISVVALPPTIKPSKEDFVLLIFWIRSPEILKGSVLPLPTPRIFLM,AERSDTSWSECFSGQFGGPVQQCSAYQSQSWLYHQLNQARRTSFCSSSGSGLQSRSNEDPFYLSPPQGFS