McDonnell Genome Institute

Washington University

CircRNA

chr20|32836633|32839856|+|MAPRE1|ENST00000375571.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9454

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

LMQQIIPVDK

Amino Acids from 5' Exons

IIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSA,FLWTNKESFRTILNSFSGSRSFSMQTMMEKTMTLWLPDKVKKLQWLLPLLLQLINRRNLSLLAVQ,NSCGQISKRKVSGQFIRSVVQEVFRCKLWKRLPCGCQTRSRNCSGSFPCCSSSETEETSHFQC

Amino Acids from 3' Exons

LPRGPSQHREPLRLLRLALVWCERTLVWATETTRQLSCS,SPEAHLNTENRCGSGWPWCGAKEPWCGQRRRRGSVDAA,PQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQ