McDonnell Genome Institute

Washington University

CircRNA

chr20|32452235|32453761|-|NOL4L|ENST00000359676.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9593

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

13

Peptide

QETTVMSPPYSSGSYDSIK

Amino Acids from 5' Exons

DEPIALDKQHSRDSAAITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNLQPPASLQTGNHSN,MSPPWTSSTRGTPQPSPTPPTHCQPPPTPRTLCTPTAASTTVTAGTGPAATCSPLPPSKQETTVM,AHSPGQAALAGLRSHHPLHLLTASLLLLPGPCVRQRRPQLQLPRVRGLEQQPAAPCLPPNRKPQ

Amino Acids from 3' Exons

SPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERLKAFN,PPPTALGATIPSRPRSAAALRTQWAGPRRQMMTTMTTMTMRTMTRTTLKAWTLSVLRPS,PPLQLWELRFHQDRGQRLPGPDSGPGPDGRRRPRPGQQDERLRHGPASGLQ