top of page

McDonnell Genome Institute

Washington University

CircRNA

chr20|32088567|32094016|+|HCK|ENST00000262651.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9748

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

EGSLLDFLK

Amino Acids from 5' Exons

EACWTFKVMRAASSHCQNSLTSQP,KLAGLSEKGQQAAIAKTHLLSP,SLLDFLKSDEGSKQPLPKLIDFSAQ

Amino Acids from 3' Exons

IAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTARE,LQKAWPSSSRGTTSTETSELPTSWSLHPWCVRLLTLAWPGSLRTTSTRLGK,CRRHGLHRAEELHPPRPPSCQHLGLCIPGVDCLWPGPGHGQRVHGSG

bottom of page