McDonnell Genome Institute

Washington University

CircRNA

chr20|2655933|2656549|+|NOP56|ENST00000329276.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9719

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

DSFSTPPSLAEQLPR

Amino Acids from 5' Exons

VGARLIAHAGSLTNLAKYPASTVQILGAEKALF,VHVSSHMLAASPTWPSIQHPQCRSLGLKRPCS,RCTSHRTCWQPHQPGQVSSIHSADPWGKGPVQ

Amino Acids from 3' Exons

SPEDKGHSKIWTHFPLHLHWPSSCQEQRPHLPIPGKQMQYCLTNRLLL,ALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFS,PRQGVTLQNMDSFSTPPSLAEQLPRTKAASPDTWQTNAVLPHESIASL