McDonnell Genome Institute

Washington University

CircRNA

chr20|2655324|2655746|+|NOP56|ENST00000329276.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

15

Peptide

MSQVAPSLSALIGEAGVVR

Amino Acids from 5' Exons

GVVRVSLSGAGEDHQRQCHILPSCPVYWKPKGTEGQAGEAGGADNGWGQGGYSGCLTVLH,EWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSM,SGTGITFRSWRSSTTMPHTAVLPSLLETEGNMRTSWRSWRSQWMGPRLRLFWMPHGPPW

Amino Acids from 3' Exons

AWTYLPLTTSRASPVVWCLYLNTARAYTLTCAPRAKPPACQPLGK,HGHICHLDKHRELLQSCGVFIIPPEPTHLPALQDEPSSPQPVSPNWGS,MDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEA