McDonnell Genome Institute

Washington University

CircRNA

chr20|25476042|25482100|-|NINL|ENST00000278886.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9135

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

TGTAPHGAR

Amino Acids from 5' Exons

ERGGGAEWRAVGAGSPARSQRPDLGAGGAAAGTPATREPEVGAAGAGEGTEAAALCEREARPDVRIVGPRGGGVGACPREASGRALPGSRDAGPAERWAGGRKWPGGHTWPPTTASGLWGAATGLAGPRWQRVGGGRSRASPQASPGHRSYAEPGPRPCPGIPRPLREVVTHAALWSGWGYCPKGARAFRRERSGAGAAWSPGAASAGNRERRLANPATDVGATPEAGRFVQGTGEATGHSGRASTKLEQGHPGAGLGAAGPGRGRPGAWVSQAQCGGCQERVLAIPPPARRPAGFLAGAACCPRRGGDQNSAGEREGHGNQTSTSGRRRPGSGETCRFERERQ,REAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKLQPCASEKRAQMCVSLALEEEELELARGKRVDGPSLEAEMQALPKDGLVAGSGQEGTRGLLPLRPGCGERPLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASHGPSERWSRMQPCGVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEPPLRPAASCRGQAERLQAIQEERARSWSRGTQEQASEQQARAEGALEPGCHKHSVEVARRGSLPSHLQLADPQGSWQEQLAAPEEGETKIALEREKDDMETKLLHLEDVVRALEKHVDLREND,ERLRRSVESCRGWEPCPLAETPWSWRSRRRDPCHAGARGRSSWSWRGHSCSPVRARSAPRCAYRWPSRRRSWSLPAGSEWTGPPWKQRCRPCRKMGWWQEVARRAHVASYHCVRAVGSGHWPGWPQVMAESLRRRQEPGLAAGKPRTQKLRRARPPPLPRHPTAPQRGGHACSPVEWMGILSQRSQSLSARAQRGWSSLEPGSCLCWEQRETPRKPSHGCGSHPGRPLRAGDRLRGYRPFRKSEHEAGAGAPRSRPRSSRPGPRAPWSLGVTSTVWRLPGEGPCHPTSSSQTRRVPGRSSLLPQKRGRPKRWRERRMTWKPNFYIWKTSSGLWRNMIERTT

Amino Acids from 3' Exons

DLQDRNDELQAELEGLWARLPKNRHSPSWSPDGRRRQLPGLGPA,TCRTATMSCKLSWKACGRGCPRTGTAPHGARMGADGSSLDSAQQ,PAGPQRAASAGRPVGAAAQEPAQPLMEPGWAQTAAPWTRPS