McDonnell Genome Institute

Washington University

CircRNA

chr20|20601681|20629590|-|RALGAPA2|ENST00000202677.11

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

QLTVGGGAVQER

Amino Acids from 5' Exons

AVFILRKEPPWGGPFLSAGGATQMPNRCDLGVPPRLEHREWKRQEILFAKKQL,LCSRSSERNHRGEVLFSQLAEPPRCDRTDAIECHHVWSTGSGKGKKYCSPKSN,CVLDPQKGTTVGRSFSLSWRSHPDVTEPMRFRSATTSGAPGVEKARNIVRQKAT

Amino Acids from 3' Exons

TVGGGAVQERAPELDGGGPTEQDKSHSNSSTLSDRRLSNSSLCSIEEEHRMVYEMVQRILLSTRGYVNFVNEVFHQ,LLVVVLCRRERLSWMVVGPRSRTKAILTAAPCRTEDSATPASVALKKSTEWCMKWYSGFSCQHEVMSTSMKYFT,CWWWCCAGESAAGWWWAHGAGQKPFQQHLVGPKTQQLQPLHRRAPNGVNGTADSLVNTRLCQLRESISP