McDonnell Genome Institute

Washington University

CircRNA

chr20|20546703|20640878|-|RALGAPA2|ENST00000202677.11

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

VLSTDILTIR

Amino Acids from 5' Exons

DILNTIIRHCPPRFFSLGFPGFSMLVGDFITAAARVLSTDILT,ISIRSGTVHPAFSPWVFLASQCWWGTSSRPLPGSLAQTF,YLKYDHKALSTPLFLPGFSWLLNAGGGLHHGRCQGPHRHFD

Amino Acids from 3' Exons

IRCEGIRLFLLWLQALQTNCAEEQVLIFACLVPGFPAVMSSRGPCTLETLINPSPSVAD,DVKESGCFFCGFKHFRQTVQKSRFFLLAWCLVSQQSCHPGALAHWRHSSIPALVLM,KMRNQAVSSVASSTSDKLCRRAGSDFCLPGAWFPSSHVIQGPLHTGDTHQSQPCS