McDonnell Genome Institute

Washington University

CircRNA

chr20|20546703|20605412|-|RALGAPA2|ENST00000202677.11

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

8

Peptide

VLSTDILTTLMVAWIR

Amino Acids from 5' Exons

DILNTIIRHCPPRFFSLGFPGFSMLVGDFITAAARVLSTDILT,ISIRSGTVHPAFSPWVFLASQCWWGTSSRPLPGSLAQTF,YLKYDHKALSTPLFLPGFSWLLNAGGGLHHGRCQGPHRHFD

Amino Acids from 3' Exons

TLMVAWIRANLCVYISRELWDDFLGVLSSLTEWEELINEWANIMDSLTAVLARTVYGVEMTNLPLDKLSEQKEKKQRGK,RSWLGSEQTSVCTFLESSGMTFLVCCPPSRNGRNLTSGPTLWTPQQCLQEPFMELRQTYLWINVNKRKRSNEAK,AHGSLDPSKPLCVHFSRALGLSWCAVLPHGMGGTYKRVGQHYGLLDSSACKNRLWSDDKPTSGIKTKGKEATRQ