McDonnell Genome Institute

Washington University

CircRNA

chr20|20503350|20511325|-|RALGAPA2|ENST00000202677.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9631

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

KEEFSSIEEK

Amino Acids from 5' Exons

VDLSTHCGFMGGLQRNGSTGQTAPYYATSTVEVIFHVSTRMPSDSDDSLTKK,WISPPTVGSWVAFSAMAAPGRRPLTMLPQLWKFSMFPLECRQTQMIPSPK,GSLHPLWVHGWPSAQWQHRADGPLLCYLNCGSDFPCFHSNAVRLRFPHQK

Amino Acids from 3' Exons

EEFSSIEEKFKIIERAEKFGLPPV,KNFHLLKKNSKLLRELKNLDSRQ,RIFIYRKIQNYESKIWTPAS