McDonnell Genome Institute

Washington University

CircRNA

chr20|20090843|20246215|+|CFAP61|ENST00000245957.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9689

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

5

Peptide

KFLASEVEDHDDLMPIFMR

Amino Acids from 5' Exons

GGRPRSHANIYALHNSEGNLRILPGRTNRGPRRESCCCV,VEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCE,WKTMTISCQYLCAMTQFRKLTVNTSWPNRPKMKRIMLLCV

Amino Acids from 3' Exons

LSHEVSYPDFNSWTPRKKTSGHTKEIFSQR,SHMKFNNLTLISTHGLPGKKLLDTEQRKFLAS,LTSLIILPFQLMDSQEKNFWTLNKGNFPA