McDonnell Genome Institute

Washington University

CircRNA

chr20|18593730|18744271|+|DTD1|ENST00000377452.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.98

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

TAVPAAGLR

Amino Acids from 5' Exons

LEESRLVPLEGAYVCCWVFPWRIRRRNWNT,WRRADCHWKGHMCVAGYFPGGYAEGTGTH,GGEQISAIGRGICVLLGISLEDTQKELEH

Amino Acids from 3' Exons

LSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREPLRRQNS,CQSSKNSSRGKKRPELRDLLNQARKETLPEKKTAVPAAGLRATCPLNGSRSSGGRIQ,VKARKTAAEERKDQSGTFIKQGKKHSPKRRPQCQQRGGRRVLTGAVAQEAEF