top of page

McDonnell Genome Institute

Washington University

CircRNA

chr20|18159083|18162945|+|CSRP2BP|ENST00000377681.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9224

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

DVYLVEHR

Amino Acids from 5' Exons

EKDVYLVEHRGRLPQRGKSHVLPFRCSGIWRARMVETCSQAPNDETRREVVCLYFENK,KKTSTWWSTVAGCLSVGSPMYFRSGAQEFGEPGWWKLVHNKPPTMKPEGEKLSASTLKIK,KRRLPGGAPWQVASAWEVPCTSVQVLRNLESQDGGNLFITSPQRNLKERSCLPLLKK

Amino Acids from 3' Exons

MTMRWKAMESTQGWSTSHPLLGQLLGQWLGSERRSEALNRSRRRVRRKNPTGWILTVKTQIQTHLCKQGLEKRGSLSWRRTQSRKSPGILPASTRKSCCSRGWKLVPVLLPLRKLGDNANLSDKRKGIGDYHFLTWIKLLMLLFCLTGFMEPKKEEFPDFQLDKPRTEPPVRTSESLTDT,RDGRRWSHRPRDGVRPTPCWVSSFWASGWGQKEGQRPTDKAGGREGGKTRQDGYQRHRFKHIFANKGRKEEASAGEGHKAERAQVYSREHLRGKAAAQEAGSLSRCCCHDSGSSETETQTDCQTSEKGGITTFLGSSCCCSFVSRDLWSQRRRNFQTSSWTSHVQNHLSGLQNPPIP,DDEMEGDGVIDPGMEYVPPPAGSVASGPVVGVRKKVRGPEQIKQEVESEEEKPDRMDIDSEDTDSNTSLQTRAREKRKPQLEKDTKPKEPRYTPVSIYEEKLLLKRLEACPGAVAMTPEARRLKRKLIVRQAKRDRGLPLFDLDQVVNAALLLVDGIYGAKEGGISRLPAGQATYRTTCQDFRILDRYQ

bottom of page