McDonnell Genome Institute

Washington University

CircRNA

chr20|1611356|1611713|-|SIRPB1|ENST00000279477.11

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GSPDHVEFK

Amino Acids from 5' Exons

GLARKSCRFSLTSPYQLQLESRPLCTALLPSLWGPSSGSEELDQAGNSTIRKKATSHGQLFQTSQRETTWTFPSASVTSPQQMPAPTTVSSGKGAPTTWSLSLEQAPSCLCV,GSWRGRAAGDSAQVHISCSWRVGHSALHCDFPDPCGAHPVVQRSWTRPGINLQSERRPLPTGNNCFRPHKEKQHGLFHPHQHHPSRCRHLLLCEVPEREPRPRGVVWSRHRAVCA,VAGEEELQVIQPDKSISVAAGESATLHCTVTSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAGTELSVR

Amino Acids from 3' Exons

GLARKSCRFSLTSPYQLQLESRPLCTALLPSLWGPSSGSEELDQAGNSTIRKKATSHGQLFQTSQRETTWTFPSASVTSPQQMPAPTTVSSGKGAPTTWSLSLEQAPSCLCV,GSWRGRAAGDSAQVHISCSWRVGHSALHCDFPDPCGAHPVVQRSWTRPGINLQSERRPLPTGNNCFRPHKEKQHGLFHPHQHHPSRCRHLLLCEVPEREPRPRGVVWSRHRAVCA,VAGEEELQVIQPDKSISVAAGESATLHCTVTSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAGTELSVR