McDonnell Genome Institute

Washington University

CircRNA

chr20|10412529|10413931|-|MKKS|ENST00000347364.7

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

EAALNLSFISK

Amino Acids from 5' Exons

VKKQLIASYRKKRKIPVGLERTGFLLGYLSVSILEHTFCRGLQSSLNFSLKANKRVLKSEVKIFGITNLSLNHSMLISFINIELFDFIATMLHIHTLIPKEFLMLKRDNAINRKMWFTKKRSSLVTTSKMSRLEAKKPSLCKSEPLTTERVRTTLSVLKRIVTSCYGPSGRLKQLHNGFGGYVCTTSQSSALLSHLLVTHPILKILTASIQNHVSSFSDCGLFTAILCCNLIENVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCRIPVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSLIVPLKGQRVIDSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTKMT,RSSFESELHIERRDEKYQLDKELASCSWDIFHRCPSWNILFAEVCKAVCKISVSKQTKEYRVKNKYLELLICHIILCLASTLNFLILPQCCIFILFLKNNFCNVIMQIEKCGLQNKNGLHLPPEVRCLVWKLRSHHCVRVNHQLRESGPHFLSKELHHAMAPQVGSSCTMALEVTCVQPHSPQLCSVTFWSHIPFRSQPPYRIMCQASVIVAYSQLFFAATLKMFRDAHPPLSLDINIFVFASVISSLRPVVVESQWTLVVLRSSFVWCVVYQVNLPVCSPERKQSMSVLSEPFCLQFQKMLKATSFERVLYLKVKELIPLYYLGYSLKCQKFNGYYLSKNQLPSRWHSFVQLYPETLLTLEKELWWSVMGFLLKMQSWTSCLTEGSSVTTILSCAKKLYIHLSSFSICIVLLPTELELWNPLKQ,KEAALNLSFISKEEMKNTSWIRKNWLLVAGISFIGVHLGTYFLQRSAKQSVKFQSQSKQKSIEESKINIWNYFVIKSFYADLHKHTFFYSHNAAYSYFNSRIIFNVKTCNKKNVVYKIKTVFTSYHLKDVSFGSEAIIVETTDNESQDHTFCLEKNCNIMLWPLRAEAAAQWLWRLRVYNLTVLSSAQSPFGHTSHFKDPDSLHTESCVKLQLWLIHSYSLLQPDKCSEIRLDTHHCHIKTSFESLHQLSQVDLWLSNPSGLYSDPPLFGAYINKTCLYAHQKGNRACQCFDPESLFAYNSRKCRPHHFRKEFNCTFKRSKSYRFHCITWDTHNVRSSINEAITYQKINCPQGGTLLYNFIRRHFHWRRNCGGQLWGFSKCSLGPAAPRKAANQPRRSCPVPKSYTSIFEAVSQYASYYCHRQNWSDSDGTPDND

Amino Acids from 3' Exons

VKKQLIASYRKKRKIPVGLERTGFLLGYLSVSILEHTFCRGLQSSLNFSLKANKRVLKSEVKIFGITNLSLNHSMLISFINIELFDFIATMLHIHTLIPKEFLMLKRDNAINRKMWFTKKRSSLVTTSKMSRLEAKKPSLCKSEPLTTERVRTTLSVLKRIVTSCYGPSGRLKQLHNGFGGYVCTTSQSSALLSHLLVTHPILKILTASIQNHVSSFSDCGLFTAILCCNLIENVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCRIPVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSLIVPLKGQRVIDSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTKMT,RSSFESELHIERRDEKYQLDKELASCSWDIFHRCPSWNILFAEVCKAVCKISVSKQTKEYRVKNKYLELLICHIILCLASTLNFLILPQCCIFILFLKNNFCNVIMQIEKCGLQNKNGLHLPPEVRCLVWKLRSHHCVRVNHQLRESGPHFLSKELHHAMAPQVGSSCTMALEVTCVQPHSPQLCSVTFWSHIPFRSQPPYRIMCQASVIVAYSQLFFAATLKMFRDAHPPLSLDINIFVFASVISSLRPVVVESQWTLVVLRSSFVWCVVYQVNLPVCSPERKQSMSVLSEPFCLQFQKMLKATSFERVLYLKVKELIPLYYLGYSLKCQKFNGYYLSKNQLPSRWHSFVQLYPETLLTLEKELWWSVMGFLLKMQSWTSCLTEGSSVTTILSCAKKLYIHLSSFSICIVLLPTELELWNPLKQ,KEAALNLSFISKEEMKNTSWIRKNWLLVAGISFIGVHLGTYFLQRSAKQSVKFQSQSKQKSIEESKINIWNYFVIKSFYADLHKHTFFYSHNAAYSYFNSRIIFNVKTCNKKNVVYKIKTVFTSYHLKDVSFGSEAIIVETTDNESQDHTFCLEKNCNIMLWPLRAEAAAQWLWRLRVYNLTVLSSAQSPFGHTSHFKDPDSLHTESCVKLQLWLIHSYSLLQPDKCSEIRLDTHHCHIKTSFESLHQLSQVDLWLSNPSGLYSDPPLFGAYINKTCLYAHQKGNRACQCFDPESLFAYNSRKCRPHHFRKEFNCTFKRSKSYRFHCITWDTHNVRSSINEAITYQKINCPQGGTLLYNFIRRHFHWRRNCGGQLWGFSKCSLGPAAPRKAANQPRRSCPVPKSYTSIFEAVSQYASYYCHRQNWSDSDGTPDND