McDonnell Genome Institute

Washington University

CircRNA

chr2|99321954|99322209|-|TXNDC9|ENST00000264255.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

LGSSDILNYR

Amino Acids from 5' Exons

VNTRQTSGNIVQETPRDQIFEAECGKSTFPLETAYQSHSHTSTAKRWENTRLCCWVYPRKYRLHHRNFRMEARFFHSLQ,CKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNY,VKYTDIWQYCPRNTSRPNFSMWKKHLSFVRDCISKSFPHHCKMGKHKIMLLGLLTEIQMTSPQKLNGGSVLLTFLIT

Amino Acids from 3' Exons

VNTRQTSGNIVQETPRDQIFEAECGKSTFPLETAYQSHSHTSTAKRWENTRLCCWVYPRKYRLHHRNFRMEARFFHSLQ,CKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNY,VKYTDIWQYCPRNTSRPNFSMWKKHLSFVRDCISKSFPHHCKMGKHKIMLLGLLTEIQMTSPQKLNGGSVLLTFLIT