McDonnell Genome Institute

Washington University

CircRNA

chr2|99064938|99078813|-|TSGA10|ENST00000355053.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9229

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

EVEQITLQGK

Amino Acids from 5' Exons

ESENRQMMEQLRKANEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQ,NLRTGKWNNFEKPMKMLKTGKIKPVNQRQITIPSNWNLSLLRQRVTDKKKIPSTERLS,IEPANDGTTSKSQRCKLGKSPSIRGRQYPQTGTYHCGRGQIKRKSRFPQQRGA

Amino Acids from 3' Exons

ITLQGKILHSEKKSAFLVEPSMIWLKKRNACKHVWIKNLRILHPLERVWQ,LYKAKYCTARRNQHSWWNPQSGRKGMPASMFGKIEYCIPWREFGNE,NFTRQNIAQREEISILGGTLNDLAKEKECLQACLDKKSENIASLGESLAMK