McDonnell Genome Institute

Washington University

CircRNA

chr2|96351830|96359193|+|NCAPH|ENST00000240423.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9123

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

10

Peptide

ITGALGLDANIDPMFQK

Amino Acids from 5' Exons

IDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLK,LIPCFRRQQPHLMSAAQQGCFCPLSTARTTEVNCCFPLMSRLSPRENLSSCQSVVKQIK,SHVSEDSSLIVQHSRGVSVHSPLPGLQKTAVSLCPDSLHGRTSRVARVRLCRNDRFK

Amino Acids from 3' Exons

GRNDFPWGWRHQDHVPPSVYETWRIFLFQSSDHVDVGWPGSLALASTQ,EEMISLGDGDIRTMCPLLSMKPGEYSYFSPRTMSMWAGPDHWRFRPRRK,KKFPLGMETSGPCAPFCLNLENILISVLGPCRCGLARITGALGLDAN