McDonnell Genome Institute

Washington University

CircRNA

chr2|96292971|96304868|-|SNRNP200|ENST00000323853.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.981

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

10

Peptide

IMEHAGKNQNSNLVLQADR

Amino Acids from 5' Exons

LPSSASGTDICGYHREKSYQAFPDHENRLKNHGTCWKKS,FRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ,SVQCLWNRHMWVSQRKKLSSVSRSMKSSMKKSWNMLEKI

Amino Acids from 3' Exons

NSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRA,TRILCSKLTVLSLTGPAGMNPQERCCPLLGSWRAPVWETRLNGPNRRCRRKEEP,LESCAPSPFSHPDPPGTHRRGAVPCWEAGGHPYGRQGSTDQTADAGGKKSQ