McDonnell Genome Institute

Washington University

CircRNA

chr2|96288662|96289379|-|SNRNP200|ENST00000323853.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9598

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

LEGFALMADMVYVTQVTELGR

Amino Acids from 5' Exons

INVLLQAFISQLKLEGFALMADMVYVTQ,STFFCKPSSHSNWRALHWLTWCMSH,QRSSASLHLTAEIGGLCTDGHGVCHT

Amino Acids from 3' Exons

VTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVRE,QNWAVPATTTSPMIQCRLTTSCSPPVRLSFSGSSHCPLSSRTSQE,DRTGPYSQPLLHHQYSADLQPAAEAHPEDAFQGLLIVLVQEHHSER