McDonnell Genome Institute

Washington University

CircRNA

chr2|96283200|96297720|-|SNRNP200|ENST00000323853.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9627

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

LVEQLFSSGGK

Amino Acids from 5' Exons

VLALHREGSDSVPGEAKQHAQGNAAKWGGLPAGAQPHGATPGGAALQL,FLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSS,SCTAPRRIFRTWRSVTARSRKRCMGWATCMRGSAPWSDAWWSSSSAQ

Amino Acids from 3' Exons

EERSRRERVRQSRMDTDLETMDLDQGGE,RKGPGESECVSLEWTQIWKPWISTRVE,GKVPERASASVSNGHRSGNHGSRPGWR