McDonnell Genome Institute

Washington University

CircRNA

chr2|9521202|9527954|-|ADAM17|ENST00000310823.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9797

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

MLLEPLWR

Amino Acids from 5' Exons

IRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLE,FAFSSLHKRNLVKSTTTWQKVTQMKKRMLGMRCC,SHSQVSTRGKTWKALQHGKKLPKRKGCLGCEDVAR

Amino Acids from 3' Exons

PLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPE,HFGDLLMIPKTKECFINLKISRMFHVCSLQKCVVIKWIMKSCSQKGTENHLK,TLEICYQRQKNVSLIRYQECFTFAVSKSVWLFKSGRVAPKRVSRQRTT