McDonnell Genome Institute

Washington University

CircRNA

chr2|88585840|88591052|-|EIF2AK3|ENST00000303236.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.923

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

11

Peptide

LCAGFSILILTGWNFSVGHFELR

Amino Acids from 5' Exons

IMVIIYHTTRGRGTNEAHRLQSDSSTTHITTRISAKRILFFFYTGGKKLQRFCFVSQQRLLCAGFSILILT,WLLSTILQEGEEQTKHTDYSQIPRQPTLQQEYPQKGSCSSFTLVERNSCNDFVLYHSNNVYCAQAFPSSSSQ,NGYYLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIVRRLFHPHPHR

Amino Acids from 3' Exons

VEFQCWPLTSVYSRHGNESRIYKHLAQEHRRVNYFRCGRTGSCHNGHSDKGFGCLESYGIQEGRTSGMGVP,WNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEEQEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQ,GISVLATLNFGIFQTWKREPDLLKAPLSPMRTQKSLKLFQMWKNRKLPWTRFRLLTGKLWHSVRREDIWNGST