McDonnell Genome Institute

Washington University

CircRNA

chr2|88562288|88571041|-|EIF2AK3|ENST00000303236.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9258

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

VRPSNIFFTMDDVVK

Amino Acids from 5' Exons

IHGNSYSHKVDIFSLGLILFELLYPFSTQMERVR,FMETAILIKWTSFLAFYLNCCIHSALRWRES,SWKQLFSSGHLFFRPDSIIAVSIQHSDGESQ

Amino Acids from 3' Exons

PSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQ,HPTYSLQWMMWSRLETLGLQWTRMRKSRRFPQCQLMPDTQDKGPNCIAQS,IQHILYNGCGQGWRLWVSDCNGPGGRADGSDPNASLCQTHRTSRDQTVYEPRA