McDonnell Genome Institute

Washington University

CircRNA

chr2|86466371|86466883|+|KDM3A|ENST00000312912.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.946

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

IQNDVINK

Amino Acids from 5' Exons

MSTKFTRGNFFLSKYKVSSENKTRCLQSRVALKVLSDWNWRLENSDAKRQLYSADKHSGKQIGVCSTSIDWPSGVLTYKGFFGRIGNCQSSTAEAPRTCTFPIGCFKCTRSESRCQPLFRKKGRTFSFSLPITEFKGIFSKSRKLLFKKQQNPE,CHKQSLPEEISSCLNTKSEALRTKPDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPTKASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVKVDNESCCSRSNNKIQN,VINKVYQRKFLPVIQSLKLEQNQMSAKQGCSQSPLRLELETKFLSQKAAVLSLRQTLIRKTDWSLFHKHLAFLRSAYLQRLLLRQNWKLPILLNCRSTNMHLPHRMFQMHQKKQVSIVIALITVQEKRNLQLLADHRIRNLQKIMKAVVQEATIKSRM

Amino Acids from 3' Exons

MSTKFTRGNFFLSKYKVSSENKTRCLQSRVALKVLSDWNWRLENSDAKRQLYSADKHSGKQIGVCSTSIDWPSGVLTYKGFFGRIGNCQSSTAEAPRTCTFPIGCFKCTRSESRCQPLFRKKGRTFSFSLPITEFKGIFSKSRKLLFKKQQNPE,CHKQSLPEEISSCLNTKSEALRTKPDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPTKASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVKVDNESCCSRSNNKIQN,VINKVYQRKFLPVIQSLKLEQNQMSAKQGCSQSPLRLELETKFLSQKAAVLSLRQTLIRKTDWSLFHKHLAFLRSAYLQRLLLRQNWKLPILLNCRSTNMHLPHRMFQMHQKKQVSIVIALITVQEKRNLQLLADHRIRNLQKIMKAVVQEATIKSRM