McDonnell Genome Institute

Washington University

CircRNA

chr2|86065273|86083168|-|POLR1A|ENST00000263857.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9524

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

TGIEEAQIGK

Amino Acids from 5' Exons

DGQPLAGLIQDHMVSGASMTTRGCFFTREHYMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQ,MANHWRDSRITWFQGQALLGVAFSPGSTIWSWCTEDSRTKWGASSFLLPSSPFRCGQEN,WPTIGGTDPGSHGFRGKHDYSGLLFHPGALYGAGVPRTHGQSGAREAPFSFHPEALSAVDRKT

Amino Acids from 3' Exons

ELRKLRENEDTHPPVPANTFLPCGRMK,NGSSDRKTRILNTHQCPRTPFCPVEE,IEEAQIGKRGYLTPTSAREHLSALWKNE