McDonnell Genome Institute

Washington University

CircRNA

chr2|86041888|86049242|-|POLR1A|ENST00000263857.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9863

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

SELSLDRR

Amino Acids from 5' Exons

MLRMWYELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDYSQEWAAQTEKSYEKSELSLD,CGCGMSWMRKAEGNTRRRRPLVLTPVCLSGVLTSTLHQCQKHLKQRLMTTVKSGQLKQRRVMRNQSFLST,AEDVVVGGKPKEIPEEGGRLSPQSVCLASHLLCISVRNINKGLQSRVGSSNREELEIRAFSRQ

Amino Acids from 3' Exons

AWKTFWSQRQMSRGNVSLKNPPTAGP,RGRHFGEAKGRCQEATYHRIHPLRAP,VEDILVKPKADVKRQRIIEESTHCGPQ