McDonnell Genome Institute

Washington University

CircRNA

chr2|85630720|85636130|+|USP39|ENST00000323701.10

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9656

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LCTQLWGAQR

Amino Acids from 5' Exons

ALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQ,LYLMFLLSGTTFWKKTIIRTSNVLQGISCSCWSSVLESESSGTLEISRHMCLPMRCFRQLYFAVRRLFRSPNK,SICSSSPELLSGRRQLEHQTSSRGYHVLVGPAFWRADEKALEPSKFQGTCVSPDASGSCTLQEDFSDHQT

Amino Acids from 3' Exons

EMALTFCLGFMLCTQLWGAQRRKRR,RWRLSVLVSECSALSSGGHKEEKE,DGVDFLSWFLNALHSALGGTKKKKK