McDonnell Genome Institute

Washington University

CircRNA

chr2|85349383|85350241|-|RETSAT|ENST00000295802.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9752

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

18

Peptide

ACGGIQWSPSCHPVEIPPIAR

Amino Acids from 5' Exons

VSPPTTVPFPCTPCWSTTTKEAFIPEGVPVKLPSTPSLFSGLGALSSQRPLCRVCCWTQLGKPV,CHPQPQCLFHARPAGQPLHERRLLSPRGFQNCLPHHPCDSAGWGRCPHKGHCAECVAGLSWESL,VTPNHSAFSMHALLVNHYMKGGFYPRGGSSEIAFHTIPVIQRAGGAVLTKATVQSVLLDSAGKAC

Amino Acids from 3' Exons

VVSSGAPHAILLKFLPLPVVQLLDRCGLLTRFSPFLQASTQSLAEVLQQLGASSELQAVLSYIFPTY,WYPVEPLMPSCNSSHCPWFSSSTGVGCLVSLHSFKHPPRAWLRSCSSWGPPLSSRQYSATSSPLT,GIQWSPSCHPVEIPPIARGSAPRQVWAADSFLSIPSSIHPEPGGPAAAGGLLAPGSTQLHLPHL