McDonnell Genome Institute

Washington University

CircRNA

chr2|85043563|85049648|+|KCMF1|ENST00000409785.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9863

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

YLEAILIMSR

Amino Acids from 5' Exons

ICPICAALPGGDPNHVTDDFAAHLTLEHRAPRDL,FVQYVQRYLEAILIMSRMTLQLILHLNTEPLEI,LSNMCSVTWRRSSCHGLCSSSYTTQSPRF

Amino Acids from 3' Exons

SFYLSYQEDVLQEDSLIPLALPLLSYNNCRCSCSNGSMPRQHGNNWRPHATQPGVLTQAVSPLQSHNPQQQPTLIQKAVSRLYRIPSFFQ,AFISVIRSETFCRRTAFLWPFRFSVTTTADAAAARTAACPGSTATTGDRTQRNPAYHKQCHHYNHTIHSNNQHSYRKQSADSTEFPVSFNK,LLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQQLETARNATRRTNTSSVTTTITQSTATTNIANTESSQQTLQNSQFLLT