McDonnell Genome Institute

Washington University

CircRNA

chr2|74519039|74520034|-|DQX1|ENST00000393951.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

17

Peptide

SAPGFTRPPLSAEEAALR

Amino Acids from 5' Exons

VARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQ,WPETQTGLEITFSPISMWPSSPHTAATEAAELLPDPHHGCSTTISPYPKTTAFPLFLRFNHR,GQRHRRDWKLPSPNPACGPALLILLLPKPQSSCQTPTMGALPQFHHIQRQLPFHCFDSTTD

Amino Acids from 3' Exons

LPLGLPVLHSVQKKLPCVGPWNTRMVTTVLSRCMKPLYK,CPWVYPSSTQCRRSCPASGPGTHGWPQFSDPGVSLYT,APGFTRPPLSAEEAALRRALEHTDGDHSSLIQVYEAFIQ