McDonnell Genome Institute

Washington University

CircRNA

chr2|74490024|74490739|+|TTC31|ENST00000459957.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9626

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

KDIVDFLR

Amino Acids from 5' Exons

DIVDFLRRLVESDPQGLHRIHVDGSSGRLQLWHHGGECRDRAQGSRLVPWEGPSDAPRSHVLSFLSLSPSQITSWATWMMKGNQLDRVTGARGLRDWAPTVVSASPSCILPKSLSPALKAPLPLPPSPVSQTACFRWPCPRSSWQK,TWIFFDGLWRVIPRACTGSMWMGAAGGCSCGTMVGSAGTGPRDRGWYPGRADPQMHPALMSFLSCLFLPPDRLPPGPLGREINWTEQGQGGGTGHLLWSPQVLPVSSPRVALPSKPLCLCHLPQCLRQPASGGHAPEAPGDRR,HSGFSSTACGESPGPAPDPCGWEQRAAAAVAPWWGVQGPGPGIEAGTLGGLTLRCTPLSCPFFPVSFSLLTDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEE

Amino Acids from 3' Exons

EANRLAEELVAEEERMKQKAEKKRLKKK,KPIAWLRSWWLRRSANRKQRKSDSRR,SQSPGGAGGGGAHETESREKATQEE