McDonnell Genome Institute

Washington University

CircRNA

chr2|73730559|73732285|-|TPRKB|ENST00000272424.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

KIVDPFQILVAANK

Amino Acids from 5' Exons

ISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKK,FQRLKNLVSQQMTLQFLFTLKREKNKIKNTYLKKVIRFLKIFLKILQKSK,FRGFEKIWYLSKHFNSNCLHRGRKTNKSRIPNISSRRSSGFSEKSSNNEYYRSQK

Amino Acids from 3' Exons

IVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNN,LLIHFRYLWQQTKQFTSTNWEKRQELYLLKLFSTFPQIT,CSISDTCGSKQSSSPLQTGKNEDKNSIYNYFQPFPKQ