McDonnell Genome Institute

Washington University

CircRNA

chr2|73550266|73573424|+|ALMS1|ENST00000484298.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9265

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

4

Peptide

RHIQDPMMPLLQTSQLR

Amino Acids from 5' Exons

DPMMPLLQTSQLRCAQEMMTSQPLLTLNIKKESTVRGLRHPCQWEKNPCRMKMQ,IQCHCSRLPSSGARHKRPLSHCHTRRNLQEGSDGILASGRKTLAEKC,SNDAIAPDFPAQVLGTRDDDLSATVNIKHKEGIYSKRVVTKASLPVGEKPLQNENA

Amino Acids from 3' Exons

SPNVIQNLKILPVLSSGQQSFTFIIPYTYQVIKIFAMNLWERVFSDILGKISFSIIQTNIENTCVFLFLIKTWTRLRQIIPERASASMIWETKKWILLKVKLEIIQNIMDKLVIHKGIRRSPQSKQLSTLVMNCGTSIGSDRGNRDSLSWVTGKNCPWWTDLIVWLKFFRIQSHILSRSQKVHMMIAEGNEVRNGVVDNSREISFRKRSGLKARKAIKIQASLKKARCFLIIELGGLIKLKLNRLNLINIFVNSQVLIIATLLRIVGPQRRVSCSQILPPTSFPAPLLLSNQIYPKQIERWLCTKGVALFPLLTLPGFKLLAMKEYACHPDELNYIAASPTNRGDTLRSGANTARKCIQVIPLLSTPEGDTS,VRMSFRIKYYPFCLQVSKVLHSSSRTPTKSRYLPIFGKECFHETFLERFLSASSRQTRTHVSSSSLSKHGQDDRLYQNKEPQHQCEFGKQRSDGYYKSSRLSKTWTNSTKGSEGHPRANNSAHCEFETVEQVSGATEATETAVGQERTVLGGPTSFGNSSESNHTFSPGLRKYTQRGTKCEGMEWTTAEKASEKEAVKPREKPKYRRAKKQGAFSSSSWEVSNNTDIIYSETARFLYKQHFFGLSALRGEAAHRYYHQHPFRHHFYCRIRYIDPNRRGGSARKELCFHYHCPADSSFWPKSMLVTQTNIIQHHQPTEEIPEAEQTQQESAEYRSSPSDFAHQKETHP,SECHSEFENTTRSVFRSAKFYIHHPVHLPSDQDICHESLGKSVFMRHSWKDFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTPEQTTQHTVSLNELWNKYRERQRQQRQPELGDRKELSLVDRLDRLAKILQNPITHSLQVSESTHDDSRGERSVKEWSGRQQQRNKLQKKKRFKSLEKSHKNTGELKKSKVLSHHRAGRSNQIKIEQIKFDKYILSKQPGFNYISNTSSDCRPSEESELLTDTTTNILSGTTSTVESDILTQTDREVALHERSSSVSTIDTARLIQAFGHERVCLSPRRIKLYSSITNQQRRYLEKRSKHSKKVLNTGHPLVTSEHTRRRHIQ