McDonnell Genome Institute

Washington University

CircRNA

chr2|71422813|71424038|+|ZNF638|ENST00000264447.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9366

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

TATISPGLK

Amino Acids from 5' Exons

PWLEKQSNKGANSNSLCTARRKYSQHSNRNFGTAGRALGRSKSNMFLCCNFGANSRRGGQRRNSSCSIRFSQYTIHKCRGVCFKSADVQLGEERGRNYPNSIVTIQCVCRRKEPQRNSRRISISRRFHFWNYTDYGRSCSSRKKNCFGNIAINLYCDVSTRNSHWGEDSGQKEYFKKRHGKGGEGIYGNQNGSSNRNREGKERDGCRKGGKDGSNERKACRKHFIQGIPKRSGSGANNYSGCIRCIQTKHQGCYSLFSGKSYSFKNKSEKFSKICAQRSNKCKETFSQGIWSATHKCQVRLGRKQQIQTYSEQSYQRRQWKDLSPARQAFTGLQRYNKTISGNRGTFHHETGQQQ,PGLKNSPIDESEVQTATDSPSVKPNELEEESTPSIQTETLVQQEEPCEEEAEKATCDSDFAVETLELETQGEEVKEEIPLVASASVSIEQFTENAEECALNQQMFNSDLEKKGAEIINPKTALLPSDSVFAEERNLKGILEESPSEAEDFISGITQTMVEAVAEVEKNETVSEILPSTCIVTLVPGIPTGDEKTVDKKNISEKKGNMDEKEEKEFNTKETRMDLQIGTEKAEKNEGRMDAEKVEKMAAMKEKPAENTLFKAYPNKGVGQANKPDETSKTSILAVSDVSSSKPSIKAVIVSSPKAKATVSKTENQKSFPKSVPRDQINAEKKLSAKEFGLLKPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIMKRDDSNNK,LAKTVQLMKVRCKQQLIVPLLNLMSLKKKVLPAFKQKLWYSRKSLVRKKLKKQHVILTLLLKLWSLKLKERRSKKKFLLHPLQSVLNNSLKMPRSVLISRCLTVTWRRKGQKLLTLKQHCYHLTVCLQKKGTSKEFKNLHLKQKISFLELHRLWKLLKKKMKLFRKYCHQLVLRYQEFPLGMRRQWTKRIFLKKKVTWMKRRRRNLILRKPEWIFKEQRRLKRMKVGWMQKRWKRWQQKKSLQKTLYSRHTQIKEWVRLISLMKLVKLVFWLYQMYLAVNQASRLLSLLLRQKLQFQKLKIRKVFQNLCPEIKMLKRNFQPRNLVCLNPQVPGQAWQKAAVNSNLLRAVLPEEAVEGSQPCKASFLNWITEIQNNLRKQRLDLPSNGMTATI

Amino Acids from 3' Exons

PWLEKQSNKGANSNSLCTARRKYSQHSNRNFGTAGRALGRSKSNMFLCCNFGANSRRGGQRRNSSCSIRFSQYTIHKCRGVCFKSADVQLGEERGRNYPNSIVTIQCVCRRKEPQRNSRRISISRRFHFWNYTDYGRSCSSRKKNCFGNIAINLYCDVSTRNSHWGEDSGQKEYFKKRHGKGGEGIYGNQNGSSNRNREGKERDGCRKGGKDGSNERKACRKHFIQGIPKRSGSGANNYSGCIRCIQTKHQGCYSLFSGKSYSFKNKSEKFSKICAQRSNKCKETFSQGIWSATHKCQVRLGRKQQIQTYSEQSYQRRQWKDLSPARQAFTGLQRYNKTISGNRGTFHHETGQQQ,PGLKNSPIDESEVQTATDSPSVKPNELEEESTPSIQTETLVQQEEPCEEEAEKATCDSDFAVETLELETQGEEVKEEIPLVASASVSIEQFTENAEECALNQQMFNSDLEKKGAEIINPKTALLPSDSVFAEERNLKGILEESPSEAEDFISGITQTMVEAVAEVEKNETVSEILPSTCIVTLVPGIPTGDEKTVDKKNISEKKGNMDEKEEKEFNTKETRMDLQIGTEKAEKNEGRMDAEKVEKMAAMKEKPAENTLFKAYPNKGVGQANKPDETSKTSILAVSDVSSSKPSIKAVIVSSPKAKATVSKTENQKSFPKSVPRDQINAEKKLSAKEFGLLKPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIMKRDDSNNK,LAKTVQLMKVRCKQQLIVPLLNLMSLKKKVLPAFKQKLWYSRKSLVRKKLKKQHVILTLLLKLWSLKLKERRSKKKFLLHPLQSVLNNSLKMPRSVLISRCLTVTWRRKGQKLLTLKQHCYHLTVCLQKKGTSKEFKNLHLKQKISFLELHRLWKLLKKKMKLFRKYCHQLVLRYQEFPLGMRRQWTKRIFLKKKVTWMKRRRRNLILRKPEWIFKEQRRLKRMKVGWMQKRWKRWQQKKSLQKTLYSRHTQIKEWVRLISLMKLVKLVFWLYQMYLAVNQASRLLSLLLRQKLQFQKLKIRKVFQNLCPEIKMLKRNFQPRNLVCLNPQVPGQAWQKAAVNSNLLRAVLPEEAVEGSQPCKASFLNWITEIQNNLRKQRLDLPSNGMTATI