top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|71363953|71393645|+|ZNF638|ENST00000410075.5

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

29

Peptide

EMILQDPQLQTTQLPQTTQAPDITWGMLK

Amino Acids from 5' Exons

KGQKRKNSTKTFSFPQSAFKIKLKSQIPSVSKPNALHVAEKSKSKNLPSFHFIQIQIQIPFTISNKSIRSKMLSISPEDVKEISEII,NEGNRKENETPRRRSHSPSPRRSRRSSSSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSRSPYRIRNPFRGSPKCFRSVSPERMSRRSVRSS,MRAIEKKMKLHEDVLIPPVLGVLEDQAQVTDSVGLEAQCITCIGREVEVQEFAIVSFLDTDPDPDPVHHIELEIHLEVVQNAFDQLALRGCQGDQDHQ

Amino Acids from 3' Exons

ALFGFQYDASDHTMAWLGPNTVPEVKEMILQDPQLQTTQLPQTTQAPDITWGMLKKTTYKAEQILLQTQKPFTPDNLFLALLSG,PSLDSSTMHQTIPWRGDPTQYQKRKSCRTRSSRQHSFLRRHKPRTLPGGCRRQLTRLSKSCSRHRNHSLQIICSLLCSL,PLWIPVRCIRPYHGVARTQHSTRSEGNDPAGPAAPDNTASSDDTSPGHYLGDAEEDNLQGANPAPDTETIHSRFVPCSALW

bottom of page