McDonnell Genome Institute

Washington University

CircRNA

chr2|71132897|71144538|+|MPHOSPH10|ENST00000244230.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9428

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

MPSQTSTLSLNR

Amino Acids from 5' Exons

DSRGIGIKVHFFNKSALLNIREWDPWKPLAKTCDRKFADLATTGIAKTNFTILSECSNNRYQSSPRERTGTRGWFRDRGQGGPRRFRGGGSVRHGSNGESKLKQISEEKPRFQGFPLYQQIGTAEQGAKQRTGKTKRKVHSRILQTLNGGLFRKHRKRRGTKRGGGRYFFRYFRRGTVWKKT,IQEGLASKFTSLTKVLYDFNKILENGRIHGSPLQKLVIENFDDEQIWQQLELQNEPILQYFQNAVSETINDEDISLLPESEEQEREEDGSEIEADDKEDLEDLEEEEVSDMGNDDPEMGERAENSSKSDLRKSPVFSDEDSDLDFDISKLEQQSKVQNKGQGKPREKSIVDDKFFKLSEMEAYLENIEKEEERKDDNDEEEEDIDFFEDIDSDEDEGGLFGSKKLK,FKRDWHQSSLLQKCFMTLIKYRMVGSMEAPCKNLKILMMSRFGNNWNCKMNQFYNTFRMQLVKQLMMKISVFSQRVKNRNVKRMVQRRLMTRRTKIRRRKCPTWVMMILKWVRELKTQANLIGKAPFSVMRILTLTLISANWNSRARCKTKDRENQEKSPMINSSNSLKWRPIKTKKKRNEKMIMMRRRKILIFLKILILMKMKGDCLEVKNL

Amino Acids from 3' Exons

QKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKP,KKQQKKKIQNMKFRRWIPSSNWMPSQTSTLSLN,KNSRRRKSRTCRNSEDDGFPLLKIGCPLKLPLYPT