McDonnell Genome Institute

Washington University

CircRNA

chr2|70274958|70275666|+|PCYOX1|ENST00000264441.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9064

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

ASAGIQK

Amino Acids from 5' Exons

DLPLPVSLCLQCRKITSCSRRRLPWNASNTSNLAKGRLFEVPQNDCSCYEGQLWPKHGHQCLC,IYRYQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFV,STATSLMTMPSVVSKNYFMLEEMTSLECLIEHFLKPCKRPAFLRSSSMKLLLLGSIMAKARTSMPLW

Amino Acids from 3' Exons

GRCHCPVLILAFGQKVAINLFAQGFCRHPKAILYLAQCTSRRKQRPSTQ,GGVTVLFFWPLGSRRWQTCLLRASAGIQKQSYIWLSNVHRGENKDQVH,AVSLSCSDSGLWAVEGGNKLVCSGLLQASKSNLISGSVMYIEEKTKTKYT