McDonnell Genome Institute

Washington University

CircRNA

chr2|70228343|70230854|-|TIA1|ENST00000477044.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9216

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

LNGVMSGQPK

Amino Acids from 5' Exons

SFTCTWIHINMVCLGNQNCWLLRKLSNTLTSNCCNA,LSSLAHGFTTEWCNVWATKTVGFENCQILHQTVAMQ,LVHLHMDSHKLNGVMSGQPKLLAFEKTVKYFNIKLLQCK

Amino Acids from 3' Exons

TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGK,QLEMIPIVLWSFMSIVMQLQHLLMDGRWV,SWKSLLFCGVSASSCSCSISCYEWTEDNG