McDonnell Genome Institute

Washington University

CircRNA

chr2|69328270|69338565|-|GFPT1|ENST00000357308.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

24

Peptide

QTRQVLEELTELPVMVELASDFLDR

Amino Acids from 5' Exons

KIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQ,KSKKLLICTLKASLLVNNMALWLWWINCLSSSEITLMPSVRMLFSKWLLG,NQRNYLYALRHPCWIETWPSGFGGIDACDHDHHERSHLCQVSECSSASGCSA

Amino Acids from 3' Exons

TRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQS,HVKFLRSLSCLWWNQVTSWTETHQSFEMMFAFSLVNQ,TSSSGADVACDGGTSKLPGQKHTSLSRCLLFPSI