McDonnell Genome Institute

Washington University

CircRNA

chr2|68513079|68538227|+|APLF|ENST00000303795.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9066

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

11

Peptide

GHPACMGQTAIETVK

Amino Acids from 5' Exons

KQSSARYIENTKIPRDFTSDYWCLTTGRKHRNSQDPDDSHKC,NSQVLDEDNILNETPKSPVINLPHETTGASQLEGSTEIAKTQMTPTNSV,TVKCLMKIIYMKHQNPPLIYLMRLLVPHNWKEAQKPRPRLPQIV

Amino Acids from 3' Exons

EMPQSFSAITLSNTEMNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSNPSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCY,KCHNHFLQSHVTQRIILRLMHRETNFQRNLVKFLNIKLPLKEHHIKKMRQAVLKIVRVPRATHFRMSLKGLILSPALIPPILKLCMQRQLIQFYKVLKETRSRGHPACMGQTAI,NATIIFCNHIKHRDEYDCTEKQTSNRGTWSFTNCHKNTTRRGNELFKLFECPGRLTSGVSRVSFVQLSLQSNFACKGNFSSTRFRKQGQEDILHVWGKLL