McDonnell Genome Institute

Washington University

CircRNA

chr2|64096412|64104830|-|PELI1|ENST00000358912.4

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9846

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

10

Peptide

TSFLGYNGSLPNGDR

Amino Acids from 5' Exons

IGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLG,LAGRLKAPLILLTRFLEVKVILIHSQYKALYQDLPAESYVNGILPLQHGFMLQDLTHQKTSFL,WPVDKPHFCSNHGSWKSKFYTVSTKHYIKICLQNHMTESSLYSTDLCCRILIKKHLSW

Amino Acids from 3' Exons

VWVSPKWRRKEEKVCFVKTGKWGEAQHCAYCLYSSGCK,YNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAK,IMGLSQMAIEEGGKVGLLCLKDLRQMGSPALCILLVLLRLQ