McDonnell Genome Institute

Washington University

CircRNA

chr2|62826086|62996766|+|EHBP1|ENST00000263991.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9203

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

SAFAISWTQESPSGRR

Amino Acids from 5' Exons

ESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKA,NPLLVEGKLLLLAASINSMQALCQLRLMSSNSSHYLKKLYLPLFSFHYLAFFGKEKP,IPFWSKESSCYQHQYETVCKPYANSDCQVKIQAIIKSCICRSSVFIILHFSEGRKSH

Amino Acids from 3' Exons

KGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDT,KGSKTPVSMENWQHRMSKSKLTPVPRWWRSAFAISWTQ,RVQRHQSVCSRRIGSTREAKANHPCRAGGEAPSLSHGH